PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00747.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 635aa    MW: 70535.6 Da    PI: 5.0004
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00747.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.6e-52281561128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lp+G+rF+Ptdeelv++yL+ k++g + ++ +vi+evdi+k+ePwdLp  + v+++++ew+fF+++d+ky++g+r nrat++gyWk
  Sme2.5_00747.1_g00003.1  28 LPVGYRFRPTDEELVNHYLRLKINGADGQV-SVIREVDICKLEPWDLPdlSVVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWK 112
                              799************************999.89**************96448888999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd+++++kkg+++g+kktLv+y grap+g++t+Wv+heyr+
  Sme2.5_00747.1_g00003.1 113 ATGKDRNIVTKKGAKIGMKKTLVYYIGRAPEGKRTHWVIHEYRA 156
                              ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-5823179IPR003441NAC domain
PROSITE profilePS5100555.3928179IPR003441NAC domain
PfamPF023651.4E-2629155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MMAVLPGENP IAVHPVDKQM GLPPLHSLPV GYRFRPTDEE LVNHYLRLKI NGADGQVSVI  60
REVDICKLEP WDLPDLSVVE SHDNEWFFFC PKDRKYQNGQ RLNRATERGY WKATGKDRNI  120
VTKKGAKIGM KKTLVYYIGR APEGKRTHWV IHEYRATEKS LDGSQPGQGA FVLCRLFRKS  180
DLKQDEHVEN SNLDAAQNTS VAKSPTEDEL SEAATPLTVI QPISDCDHSN SAKFSKGKVN  240
GKQIPLESHS NSCIADDTED QMLDITSIPP VQNLEKELGN LCDPSSQPLD WKIFSPLHSQ  300
MQVELGSSYL QAPLNNDICG YPKDVQFQYG TNAHEINDFL DSILINSDEF SCEDSGQEFL  360
SHHIDTKNYS ITGPMFKDTG SCSESEAEVT QRLVEPDFFD PEVLWDNFDR EAAVKREASS  420
LEGTVLQMYS APGAPYVSND HAVGSLGFPE STYSGHYDYP PSFDGSKVPD FPKVAQSGVC  480
NNMVSSESAS GTGIKLRTRQ MHNQPDDMQS KPQGTAPRRI RLQKKLQAGP VECRKRTDSS  540
QGAERLQGEK ASDEHISTTS DTTHEEFEGV NGEADDLSTR VKDADDSPVQ ESLDVSLKTG  600
TKLSSSSRVY LSKVVVVASL LVVFIGVWGC FRLYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-442718416170NAC domain-containing protein 19
4dul_A2e-442718416170NAC domain-containing protein 19
1ut7_B2e-442718416170NO APICAL MERISTEM PROTEIN
1ut7_A2e-442718416170NO APICAL MERISTEM PROTEIN
1ut4_B2e-442718416170NO APICAL MERISTEM PROTEIN
1ut4_A2e-442718416170NO APICAL MERISTEM PROTEIN
3swp_D2e-442718419173NAC domain-containing protein 19
3swp_C2e-442718419173NAC domain-containing protein 19
3swp_B2e-442718419173NAC domain-containing protein 19
3swp_A2e-442718419173NAC domain-containing protein 19
3swm_D2e-442718419173NAC domain-containing protein 19
3swm_C2e-442718419173NAC domain-containing protein 19
3swm_B2e-442718419173NAC domain-containing protein 19
3swm_A2e-442718419173NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4375220.0KF437522.1 Solanum tuberosum putative membrane bound NAC transcription factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001274765.10.0uncharacterized LOC102593794
TrEMBLA0A0V0IMV40.0A0A0V0IMV4_SOLCH; Putative nam-like protein 1-like
STRINGPGSC0003DMT4000014980.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.13e-86NAC domain containing protein 62